Recombinant Cricetulus griseus Peroxiredoxin-1 (PRDX1), Unconjugated, Yeast

Catalog Number: BIM-RPC26082
Article Name: Recombinant Cricetulus griseus Peroxiredoxin-1 (PRDX1), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC26082
Supplier Catalog Number: RPC26082
Alternative Catalog Number: BIM-RPC26082-20UG,BIM-RPC26082-100UG,BIM-RPC26082-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Hamster
Conjugation: Unconjugated
Alternative Names: Thioredoxin peroxidase 2 (TPX-2, TDPX2)
Recombinant Cricetulus griseus Peroxiredoxin-1 (PRDX1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). Target Name: PRDX1. Target Synonyms: Thioredoxin peroxidase 2 (TPX-2, TDPX2). Accession Number: Q9JKY1. Expression Region: 2~199aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 24.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 24.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: SSGNAKIGYPAPNFKATAVMPDGQFRDICLSEYRGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Target: PRDX1