Recombinant Mouse Tenomodulin (Tnmd), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC26049
Article Name: Recombinant Mouse Tenomodulin (Tnmd), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26049
Supplier Catalog Number: RPC26049
Alternative Catalog Number: BIM-RPC26049-20UG,BIM-RPC26049-100UG,BIM-RPC26049-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Chondromodulin-1-like protein (ChM1L, mChM1L, Chondromodulin-I-like protein, Myodulin, Tendin, TeM, mTeM, Chm1l)
Recombinant Mouse Tenomodulin (Tnmd), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Tnmd. Target Synonyms: Chondromodulin-1-like protein (ChM1L, mChM1L, Chondromodulin-I-like protein, Myodulin, Tendin, TeM, mTeM, Chm1l). Accession Number: Q9EP64. Expression Region: 51~317aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 35.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 35.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMP
Target: Tnmd