Recombinant Human Myeloid differentiation primary response protein MyD88 (MYD88), Unconjugated, E. coli

Catalog Number: BIM-RPC26047
Article Name: Recombinant Human Myeloid differentiation primary response protein MyD88 (MYD88), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26047
Supplier Catalog Number: RPC26047
Alternative Catalog Number: BIM-RPC26047-20UG,BIM-RPC26047-100UG,BIM-RPC26047-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Mutant myeloid differentiation primary response 88, MYD 88, Myd88, MYD88_HUMAN, MYD88D, Myeloid differentiation marker 88, Myeloid differentiation primary response 88, Myeloid differentiation primary response gene (88), Myeloid differentiation primary response gene 88, Myeloid differentiation primary response gene, Myeloid differentiation primary response protein MyD88, OTTHUMP00000161718, OTTHUMP00000208595, OTTHUMP00000209058, OTTHUMP00000209059, OTTHUMP00000209060
Recombinant Human Myeloid differentiation primary response protein MyD88 (MYD88) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MYD88. Target Synonyms: Mutant myeloid differentiation primary response 88, MYD 88, Myd88, MYD88_HUMAN, MYD88D, Myeloid differentiation marker 88, Myeloid differentiation primary response 88, Myeloid differentiation primary response gene (88). Accession Number: Q99836. Expression Region: 1~296aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 37.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 37.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPI
Target: MYD88