Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC26041
Article Name: Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26041
Supplier Catalog Number: RPC26041
Alternative Catalog Number: BIM-RPC26041-20UG,BIM-RPC26041-100UG,BIM-RPC26041-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: GP-C
Recombinant Lassa virus Pre-glycoprotein polyprotein GP complex (GPC), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV). Target Name: GPC. Target Synonyms: GP-C. Accession Number: P08669. Expression Region: 59~259aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: TSLYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNLSDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHCGTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIGYLGLLSQRTRDIYISRRLL
Target: GPC