Recombinant Human Insulin growth factor-like family member 1 (IGFL1), Unconjugated, E. coli

Catalog Number: BIM-RPC26012
Article Name: Recombinant Human Insulin growth factor-like family member 1 (IGFL1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC26012
Supplier Catalog Number: RPC26012
Alternative Catalog Number: BIM-RPC26012-20UG,BIM-RPC26012-100UG,BIM-RPC26012-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: IGFL1, UNQ644/PRO1274, Insulin growth factor-like family member 1
Recombinant Human Insulin growth factor-like family member 1 (IGFL1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: IGFL1. Target Synonyms: IGFL1, UNQ644/PRO1274, Insulin growth factor-like family member 1. Accession Number: Q6UW32. Expression Region: 25~110aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 16.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 16.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS
Target: IGFL1