Recombinant Human Apoptosis regulator Bcl-2 (BCL2), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25986
Article Name: Recombinant Human Apoptosis regulator Bcl-2 (BCL2), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25986
Supplier Catalog Number: RPC25986
Alternative Catalog Number: BIM-RPC25986-20UG,BIM-RPC25986-100UG,BIM-RPC25986-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Apoptosis regulator Bcl 2, Apoptosis regulator Bcl-2, Apoptosis regulator Bcl2, AW986256, B cell CLL/lymphoma 2, B cell leukemia/lymphoma 2, Bcl-2, Bcl2, BCL2_HUMAN, C430015F12Rik, D630044D05Rik, D830018M01Rik, Leukemia/lymphoma, B-cell, 2, Oncogene B-cell leukemia 2, PPP1R50, Protein phosphatase 1 regulatory subunit 50, Protein phosphatase 1, regulatory subunit 50
Recombinant Human Apoptosis regulator Bcl-2 (BCL2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: BCL2. Target Synonyms: Apoptosis regulator Bcl 2, Apoptosis regulator Bcl-2, Apoptosis regulator Bcl2, AW986256, B cell CLL/lymphoma 2, B cell leukemia/lymphoma 2, Bcl-2, Bcl2, BCL2_HUMAN, C430015F12Rik, D630044D05Rik, D830018M01Rik, Leukemia/lymphoma, B-cell, 2. Accession Number: P10415. Expression Region: 2~211aa. Tag Info: C-Terminal 10Xhis-Tagged. Theoretical MW: 25.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.2kDa
Tag: C-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: AHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Target: BCL2