Recombinant Helicobacter pylori Bacterial non-heme ferritin (ftnA), Unconjugated, E. coli

Catalog Number: BIM-RPC25962
Article Name: Recombinant Helicobacter pylori Bacterial non-heme ferritin (ftnA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25962
Supplier Catalog Number: RPC25962
Alternative Catalog Number: BIM-RPC25962-20UG,BIM-RPC25962-100UG,BIM-RPC25962-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: H. pylori
Conjugation: Unconjugated
Alternative Names: pfr
Recombinant Helicobacter pylori Bacterial non-heme ferritin (ftnA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori). Target Name: ftnA. Target Synonyms: pfr. Accession Number: P52093. Expression Region: 1~167aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 24.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 24.8kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MLSKDIIKLLNEQVNKEMNSSNLYMSMSSWCYTHSLDGAGLFLFDHAAEEYEHAKKLIVFLNENNVPVQLTSISAPEHKFEGLTQIFQKAYEHEQHISESINNIVDHAIKGKDHATFNFLQWYVSEQHEEEVLFKDILDKIELIGNENHGLYLADQYVKGIAKSRKS
Target: ftnA