Recombinant Abrus precatorius Abrin-a, Unconjugated, Yeast

Catalog Number: BIM-RPC25941
Article Name: Recombinant Abrus precatorius Abrin-a, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25941
Supplier Catalog Number: RPC25941
Alternative Catalog Number: BIM-RPC25941-20UG,BIM-RPC25941-100UG,BIM-RPC25941-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: rRNA N-glycosidase
Recombinant Abrus precatorius Abrin-a is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Abrus precatorius (Indian licorice) (Glycine abrus). Target Name: Abrus precatorius Abrin-a. Target Synonyms: rRNA N-glycosidase. Accession Number: P11140. Expression Region: 1~251aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 30.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QDRPIKFSTEGATSQSYKQFIEALRERLRGGLIHDIPVLPDPTTLQERNRYITVELSNSDTESIEVGIDVTNAYVVAYRAGTQSYFLRDAPSSASDYLFTGTDQHSLPFYGTYGDLERWAHQSRQQIPLGLQALTHGISFFRSGGNDNEEKARTLIVIIQMVAEAARFRYISNRVRVSIQTGTAFQPDAAMISLENNWDNLSRGVQESVQDTFPNQVTLTNIRNEPVIVDSLSHPTVAVLALMLFVCNPPN
Target: Abrus precatorius Abrin-a