Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1, Unconjugated, E. coli

Catalog Number: BIM-RPC25892
Article Name: Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25892
Supplier Catalog Number: RPC25892
Alternative Catalog Number: BIM-RPC25892-20UG,BIM-RPC25892-100UG,BIM-RPC25892-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Allergen Api g 1.0101Allergen Api g IAllergen: Api g 1
Recombinant Apium graveolens Major allergen Api g 1, isoallergen 1 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Apium graveolens (Celery). Target Name: Apium graveolens Major allergen Api g 1, isoallergen 1. Target Synonyms: Allergen Api g 1.0101Allergen Api g IAllergen: Api g 1. Accession Number: P49372. Expression Region: 1~154aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 32.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 32.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MGVQTHVLELTSSVSAEKIFQGFVIDVDTVLPKAAPGAYKSVEIKGDGGPGTLKIITLPDGGPITTMTLRIDGVNKEALTFDYSVIDGDILLGFIESIENHVVLVPTADGGSICKTTAIFHTKGDAVVPEENIKYANEQNTALFKALEAYLIAN
Target: Apium graveolens Major allergen Api g 1, isoallergen 1