Recombinant Chicken Interleukin-8 (CXCL8), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25876
Article Name: Recombinant Chicken Interleukin-8 (CXCL8), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25876
Supplier Catalog Number: RPC25876
Alternative Catalog Number: BIM-RPC25876-20UG,BIM-RPC25876-100UG,BIM-RPC25876-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Gallus
Conjugation: Unconjugated
Alternative Names: 9E3C-X-C motif chemokine EF-4Chemokine (C-X-C motif) ligand 8Embryo fibroblast protein 1, EMF-1
Recombinant Chicken Interleukin-8 (CXCL8), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Chicken (Gallus). Target Name: CXCL8. Target Synonyms: 9E3C-X-C motif chemokine EF-4Chemokine (C-X-C motif) ligand 8Embryo fibroblast protein 1, EMF-1. Accession Number: P08317. Expression Region: 17~102aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 13.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 13.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ALSQGRTLVKMGNELRCQCISTHSKFIHPKSIQDVKLTPSGPHCKNVEIIATLKDGREVCLDPTAPWVQLIVKALMAKAQLNSDAP
Target: CXCL8