Recombinant Human Podocalyxin (PODXL), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25871
Article Name: Recombinant Human Podocalyxin (PODXL), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25871
Supplier Catalog Number: RPC25871
Alternative Catalog Number: BIM-RPC25871-20UG,BIM-RPC25871-100UG,BIM-RPC25871-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: GCTM-2 antigen, Gp200Podocalyxin-like protein 1, PC, PCLP-1
Recombinant Human Podocalyxin (PODXL), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: PODXL. Target Synonyms: GCTM-2 antigen, Gp200Podocalyxin-like protein 1, PC, PCLP-1. Accession Number: O00592. Expression Region: 32~458aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 48.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 48.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPAS
Target: PODXL