Recombinant Human Interleukin-8 (CXCL8), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25857
Article Name: Recombinant Human Interleukin-8 (CXCL8), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25857
Supplier Catalog Number: RPC25857
Alternative Catalog Number: BIM-RPC25857-20UG,BIM-RPC25857-100UG,BIM-RPC25857-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin, Granulocyte chemotactic protein 1, GCP-1Monocyte-derived neutrophil chemotactic factor, MDNCFMonocyte-derived neutrophil-activating peptide, MONAPNeutrophil-activating protein 1, NAP-1, Protein 3-10CT-cell chemotactic factor
Recombinant Human Interleukin-8 (CXCL8), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CXCL8. Target Synonyms: C-X-C motif chemokine hemokine (C-X-C motif) ligand 8Emoctakin, Granulocyte chemotactic protein 1, GCP-1Monocyte-derived neutrophil chemotactic factor, MDNCFMonocyte-derived neutrophil-activating peptide, MONAPNeutrophil-activating protein 1, NAP-1, Protein 3-10CT-cell chemotactic factor. Accession Number: P10145. Expression Region: 23~99aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 13.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 13.0kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: AVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Target: CXCL8