Recombinant E. coli Peptidoglycan-associated lipoprotein (pal), Unconjugated

Catalog Number: BIM-RPC25828
Article Name: Recombinant E. coli Peptidoglycan-associated lipoprotein (pal), Unconjugated
Biozol Catalog Number: BIM-RPC25828
Supplier Catalog Number: RPC25828
Alternative Catalog Number: BIM-RPC25828-20UG,BIM-RPC25828-100UG,BIM-RPC25828-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: Tol-Pal system lipoprotein Pal (excC, PAL)
Recombinant E. coli Peptidoglycan-associated lipoprotein (pal) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: pal. Target Synonyms: Tol-Pal system lipoprotein Pal (excC, PAL). Accession Number: P0A912. Expression Region: 22~173aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 24.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 24.1kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: CSSNKNASNDGSEGMLGAGTGMDANGGNGNMSSEEQARLQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY
Target: pal