Recombinant Lentinula edodes Serine protease inhibitor, Unconjugated, E. coli

Catalog Number: BIM-RPC25805
Article Name: Recombinant Lentinula edodes Serine protease inhibitor, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25805
Supplier Catalog Number: RPC25805
Alternative Catalog Number: BIM-RPC25805-20UG,BIM-RPC25805-100UG,BIM-RPC25805-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Serine protease inhibitor
Recombinant Lentinula edodes Serine protease inhibitor is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Lentinula edodes (Shiitake mushroom) (Lentinus edodes). Target Name: Lentinula edodes Serine protease inhibitor. Target Synonyms: Serine protease inhibitor. Accession Number: P81639. Expression Region: 1~142aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 20.0kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 20.0kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SLETGRYLIHNGNNIVSRNLAEDRSLNPKRIVLLEPTDKIQLTWIIEKSGDEYILNNRGAPTAHIEDHVFALLIHQEGATKWSIEAVPRHGRNAYIIKGSDGKGWVAPDKAGEQIIYRTLIVGPSEPPTFPLNQVFQIIKLE
Target: Lentinula edodes Serine protease inhibitor