Recombinant Human immunodeficiency virus type 1 group M subtype K Protein Vpr (vpr), Unconjugated, E. coli

Catalog Number: BIM-RPC25803
Article Name: Recombinant Human immunodeficiency virus type 1 group M subtype K Protein Vpr (vpr), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25803
Supplier Catalog Number: RPC25803
Alternative Catalog Number: BIM-RPC25803-20UG,BIM-RPC25803-100UG,BIM-RPC25803-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: R ORF protein (Viral protein R)
Recombinant Human immunodeficiency virus type 1 group M subtype K Protein Vpr (vpr) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human immunodeficiency virus type 1 group M subtype K (isolate 96CM-MP535) (HIV-1). Target Name: vpr. Target Synonyms: R ORF protein (Viral protein R). Accession Number: P0C1P2. Expression Region: 1~96aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 18.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 18.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MEQAPEDQGPQREPNNEWTLEILEELKREAVRHFPRPWLHNLGQHIYTTYGDTWEGLEAIIRILQQLLFIHFRIGCHHSRIGIIPQRRGRNGSSRS
Target: vpr