Recombinant Rat Serotransferrin (Tf), Unconjugated, E. coli

Catalog Number: BIM-RPC25795
Article Name: Recombinant Rat Serotransferrin (Tf), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25795
Supplier Catalog Number: RPC25795
Alternative Catalog Number: BIM-RPC25795-20UG,BIM-RPC25795-100UG,BIM-RPC25795-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Rat
Conjugation: Unconjugated
Alternative Names: Beta-1 metal-binding globulin (Liver regeneration-related protein LRRG03, Siderophilin, Transferrin)
Recombinant Rat Serotransferrin (Tf) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rat (Rattus norvegicus). Target Name: Tf. Target Synonyms: Beta-1 metal-binding globulin (Liver regeneration-related protein LRRG03, Siderophilin, Transferrin). Accession Number: P12346. Expression Region: 20~698aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 89.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 89.9kDa
Tag: N-Terminal 6Xhis-Ksi-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: VPDKTVKWCAVSEHENTKCISFRDHMKTVLPADGPRLACVKKTSYQDCIKAISGGEADAITLDGGWVYDAGLTPNNLKPVAAEFYGSLEHPQTHYLAVAVVKKGTDFQLNQLQGKKSCHTGLGRSAGWIIPIGLLFCNLPEPRKPLEKAVASFFSGSCVPCADPVAFPQLCQLCPGCGCSPTQPFFGYVGAFKCLRDGGGDVAFVKHTTIFEVLPQKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARN
Target: Tf