Recombinant Trypanosoma cruzi Heat shock protein 100 (HSP100), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25787
Article Name: Recombinant Trypanosoma cruzi Heat shock protein 100 (HSP100), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25787
Supplier Catalog Number: RPC25787
Alternative Catalog Number: BIM-RPC25787-20UG,BIM-RPC25787-100UG,BIM-RPC25787-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Parasite
Conjugation: Unconjugated
Alternative Names: Protein CLP
Recombinant Trypanosoma cruzi Heat shock protein 100 (HSP100), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Trypanosoma cruzi. Target Name: HSP100. Target Synonyms: Protein CLP. Accession Number: O15885. Expression Region: 1~138aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 22.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 22.9kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: NSPKGLEATREKVWQVVRSYFRPEFLNRLDDIVLFRRLGFGELHEIIDLIVAEVNGRLRSQDILLEVTDEAKNFVLENAFDAEMGARPLRRWVEKYITTEVSRMILAQQLPPNSTVRVLVNGSQGKLAFSVKRSFVSE
Target: HSP100