Recombinant Human Retinoblastoma-like protein 2 (RBL2), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25775
Article Name: Recombinant Human Retinoblastoma-like protein 2 (RBL2), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25775
Supplier Catalog Number: RPC25775
Alternative Catalog Number: BIM-RPC25775-20UG,BIM-RPC25775-100UG,BIM-RPC25775-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: 130 kDa retinoblastoma-associated protein (p130, Retinoblastoma-related protein 2, RBR-2, pRb2, RB2)
Recombinant Human Retinoblastoma-like protein 2 (RBL2), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RBL2. Target Synonyms: 130 kDa retinoblastoma-associated protein (p130, Retinoblastoma-related protein 2, RBR-2, pRb2, RB2). Accession Number: Q08999. Expression Region: 417~616aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: TPVSTATHSLSRLHTMLTGLRNAPSEKLEQILRTCSRDPTQAIANRLKEMFEIYSQHFQPDEDFSNCAKEIASKHFRFAEMLYYKVLESVIEQEQKRLGDMDLSGILEQDAFHRSLLACCLEVVTFSYKPPGNFPFITEIFDVPLYHFYKVIEVFIRAEDGLCREVVKHLNQIEEQILDHLAWKPESPLWEKIRDNENRV
Target: RBL2