Recombinant Human Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1), Unconjugated, E. coli

Catalog Number: BIM-RPC25774
Article Name: Recombinant Human Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25774
Supplier Catalog Number: RPC25774
Alternative Catalog Number: BIM-RPC25774-20UG,BIM-RPC25774-100UG,BIM-RPC25774-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: CaMKII inhibitory protein alpha (CaMKIIN-alpha)
Recombinant Human Calcium/calmodulin-dependent protein kinase II inhibitor 1 (CAMK2N1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CAMK2N1. Target Synonyms: CaMKII inhibitory protein alpha (CaMKIIN-alpha). Accession Number: Q7Z7J9. Expression Region: 1~78aa. Tag Info: N-Terminal 6Xhis-Trx-Tagged. Theoretical MW: 25.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.6kDa
Tag: N-Terminal 6Xhis-Trx-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQNKRPPKLGQIGRSKRVVIEDDRIDDVLKNMTDKAPPGV
Target: CAMK2N1