Recombinant Bacillus subtilis Subtilosin-A (sboA), Unconjugated, E. coli

Catalog Number: BIM-RPC25760
Article Name: Recombinant Bacillus subtilis Subtilosin-A (sboA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25760
Supplier Catalog Number: RPC25760
Alternative Catalog Number: BIM-RPC25760-20UG,BIM-RPC25760-100UG,BIM-RPC25760-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Antilisterial bacteriocin subtilosin (sbo)
Recombinant Bacillus subtilis Subtilosin-A (sboA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168). Target Name: sboA. Target Synonyms: Antilisterial bacteriocin subtilosin (sbo). Accession Number: O07623. Expression Region: 9~43aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 18.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 18.8kDa
Tag: N-Terminal 6Xhis-Ksi-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG
Target: sboA