Recombinant Candida albicans Acetyl-CoA carboxylase (ACC1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25751
Article Name: Recombinant Candida albicans Acetyl-CoA carboxylase (ACC1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25751
Supplier Catalog Number: RPC25751
Alternative Catalog Number: BIM-RPC25751-20UG,BIM-RPC25751-100UG,BIM-RPC25751-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Fungi
Conjugation: Unconjugated
Recombinant Candida albicans Acetyl-CoA carboxylase (ACC1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast). Target Name: ACC1. Accession Number: A0A1D8PRR7. Expression Region: 217~775aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 67.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 67.3kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GSAMRSLGDKISSTIVAQHAQVPCIPWSGTGVDEVKIDPQTNLVSVADDIYAKGCCTSPEDGLEKAKKIGFPVMIKASEGGGGKGIRKVDDEKNFITLYNQAANEIPGSPIFIMKLAGDARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIARKETFHEMENAAVRLGKLVGYVSAGTVEYLYSHAEDKFYFLELNPRLQVEHPTTEMVTGVNLPAAQLQIAMGIPMHRIRDIRTLYGADPHTTTD
Target: ACC1