Recombinant Pongo abelii Transmembrane protein 168 (TMEM168), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25750
Article Name: Recombinant Pongo abelii Transmembrane protein 168 (TMEM168), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25750
Supplier Catalog Number: RPC25750
Alternative Catalog Number: BIM-RPC25750-20UG,BIM-RPC25750-100UG,BIM-RPC25750-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: TMEM168, Transmembrane protein 168
Recombinant Pongo abelii Transmembrane protein 168 (TMEM168), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii). Target Name: TMEM168. Target Synonyms: TMEM168, Transmembrane protein 168. Accession Number: Q5RD28. Expression Region: 527~637aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 19.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 19.8kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: EWWREKNGSFCSRLIIVLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTLHLPTGSDVAK
Target: TMEM168