Recombinant Mouse Ig kappa chain V-V region K2, Unconjugated, E. coli

Catalog Number: BIM-RPC25748
Article Name: Recombinant Mouse Ig kappa chain V-V region K2, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25748
Supplier Catalog Number: RPC25748
Alternative Catalog Number: BIM-RPC25748-20UG,BIM-RPC25748-100UG,BIM-RPC25748-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Ig kappa chain V-V region K2, Fragment
Recombinant Mouse Ig kappa chain V-V region K2 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Mouse Ig kappa chain V-V region K2. Target Synonyms: Ig kappa chain V-V region K2, Fragment. Accession Number: P01635. Expression Region: 21~115aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 17.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 17.4kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYNAKTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTP
Target: Mouse Ig kappa chain V-V region K2