Recombinant E. coli Uncharacterized protein yjbL (yjbL), Unconjugated

Catalog Number: BIM-RPC25739
Article Name: Recombinant E. coli Uncharacterized protein yjbL (yjbL), Unconjugated
Biozol Catalog Number: BIM-RPC25739
Supplier Catalog Number: RPC25739
Alternative Catalog Number: BIM-RPC25739-20UG,BIM-RPC25739-100UG,BIM-RPC25739-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: yjbL, b4047, JW4007, Uncharacterized protein YjbL
Recombinant E. coli Uncharacterized protein yjbL (yjbL) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: yjbL. Target Synonyms: yjbL, b4047, JW4007, Uncharacterized protein YjbL. Accession Number: P32693. Expression Region: 1~84aa. Tag Info: N-Terminal 6Xhis-Ksi-Tagged. Theoretical MW: 25.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.1kDa
Tag: N-Terminal 6Xhis-Ksi-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MLKIIPGATGYFNKTLNSNQFDNEDAIKDKLDNRGSIKGKLNNIYGKSIDYAALRHRDIIIAKIDLFIQRITHNLWHARKKMCF
Target: yjbL