Recombinant Saccharomyces cerevisiae Heat shock protein SSA1 (SSA1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25731
Article Name: Recombinant Saccharomyces cerevisiae Heat shock protein SSA1 (SSA1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25731
Supplier Catalog Number: RPC25731
Alternative Catalog Number: BIM-RPC25731-20UG,BIM-RPC25731-100UG,BIM-RPC25731-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Yeast
Conjugation: Unconjugated
Alternative Names: Heat shock protein YG100
Recombinant Saccharomyces cerevisiae Heat shock protein SSA1 (SSA1), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Bakers yeast). Target Name: SSA1. Target Synonyms: Heat shock protein YG100. Accession Number: P10591. Expression Region: 443~642aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 28.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: ERAKTKDNNLLGKFELSGIPPAPRGVPQIEVTFDVDSNGILNVSAVEKGTGKSNKITITNDKGRLSKEDIEKMVAEAEKFKEEDEKESQRIASKNQLESIAYSLKNTISEAGDKLEQADKDTVTKKAEETISWLDSNTTASKEEFDDKLKELQDIANPIMSKLYQAGGAPGGAAGGAPGGFPGGAPPAPEAEGPTVEEVD
Target: SSA1