Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR), Unconjugated, Yeast

Catalog Number: BIM-RPC25704
Article Name: Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25704
Supplier Catalog Number: RPC25704
Alternative Catalog Number: BIM-RPC25704-20UG,BIM-RPC25704-100UG,BIM-RPC25704-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Protein B5
Recombinant Vaccinia virus Truncated plaque-size/host range protein (PS/HR) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Vaccinia virus (strain LC16m8) (VACV). Target Name: PS/HR. Target Synonyms: Protein B5. Accession Number: P24284. Expression Region: 18~92aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 10.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 10.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSDYVSELYDKPLYK
Target: PS/HR