Recombinant Human 40S ribosomal protein SA (RPSA), Unconjugated, E. coli

Catalog Number: BIM-RPC25703
Article Name: Recombinant Human 40S ribosomal protein SA (RPSA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25703
Supplier Catalog Number: RPC25703
Alternative Catalog Number: BIM-RPC25703-20UG,BIM-RPC25703-100UG,BIM-RPC25703-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: 37 kDa laminin receptor precursor (37LRP, 37/67 kDa laminin receptor, LRP/LR, 67 kDa laminin receptor, 67LR, Colon carcinoma laminin-binding protein, Laminin receptor 1, LamR, Laminin-binding protein precursor p40, LBP/p40, Multidrug resistance-associated protein MGr1-Ag, NEM/1CHD4, Small ribosomal subunit protein uS2, LAMBR, LAMR1)
Recombinant Human 40S ribosomal protein SA (RPSA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RPSA. Target Synonyms: 37 kDa laminin receptor precursor (37LRP, 37/67 kDa laminin receptor, LRP/LR, 67 kDa laminin receptor, 67LR, Colon carcinoma laminin-binding protein, Laminin receptor 1, LamR, Laminin-binding protein precursor p40, LBP/p40. Accession Number: P08865. Expression Region: 2~295aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 37.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 37.7kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SGALDVLQMKEEDVLKFLAAGTHLGGTNLDFQMEQYIYKRKSDGIYIINLKRTWEKLLLAARAIVAIENPADVSVISSRNTGQRAVLKFAAATGATPIAGRFTPGTFTNQIQAAFREPRLLVVTDPRADHQPLTEASYVNLPTIALCNTDSPLRYVDIAIPCNNKGAHSVGLMWWMLAREVLRMRGTISREHPWEVMPDLYFYRDPEEIEKEEQAAAEKAVTKEEFQGEWTAPAPEFTATQPEVADWSEGVQVPS
Target: RPSA