Recombinant Bovine Serum amyloid A protein (SAA1), Unconjugated, E. coli

Catalog Number: BIM-RPC25699
Article Name: Recombinant Bovine Serum amyloid A protein (SAA1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25699
Supplier Catalog Number: RPC25699
Alternative Catalog Number: BIM-RPC25699-20UG,BIM-RPC25699-100UG,BIM-RPC25699-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bovine
Conjugation: Unconjugated
Alternative Names: Amyloid fibril protein AA (SAA)
Recombinant Bovine Serum amyloid A protein (SAA1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: SAA1. Target Synonyms: Amyloid fibril protein AA (SAA). Accession Number: P35541. Expression Region: 19~130aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 30.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: QWMSFFGEAYEGAKDMWRAYSDMREANYKGADKYFHARGNYDAAQRGPGGAWAAKVISDARENIQRFTDPLFKGTTSGQGQEDSRADQAANEWGRSGKDPNHFRPAGLPDKY
Target: SAA1