Recombinant Mouse Bone morphogenetic protein 3 (Bmp3), Unconjugated, E. coli

Catalog Number: BIM-RPC25694
Article Name: Recombinant Mouse Bone morphogenetic protein 3 (Bmp3), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25694
Supplier Catalog Number: RPC25694
Alternative Catalog Number: BIM-RPC25694-20UG,BIM-RPC25694-100UG,BIM-RPC25694-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: Bmp3Bone morphogenetic protein 3, BMP-3
Recombinant Mouse Bone morphogenetic protein 3 (Bmp3) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Bmp3. Target Synonyms: Bmp3Bone morphogenetic protein 3, BMP-3. Accession Number: Q8BHE5. Expression Region: 359~468aa. Tag Info: C-Terminal Myc-Tagged. Theoretical MW: 13.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 13.9kDa
Tag: C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: QWVEPRNCARRYLKVDFADIGWSEWIISPKSFDAFYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVSGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVDSCACR
Target: Bmp3