Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13), Unconjugated, E. coli

Catalog Number: BIM-RPC25683
Article Name: Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25683
Supplier Catalog Number: RPC25683
Alternative Catalog Number: BIM-RPC25683-20UG,BIM-RPC25683-100UG,BIM-RPC25683-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Other
Conjugation: Unconjugated
Alternative Names: RPS13, 40S ribosomal protein S13
Recombinant Ciona intestinalis 40S ribosomal protein S13 (RPS13) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis). Target Name: RPS13. Target Synonyms: RPS13, 40S ribosomal protein S13. Accession Number: Q8I7D6. Expression Region: 2~151aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 23.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 23.9kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GRMHAPGKGLSSSALPYRRSVPTWLKLSSEDVKEQIYKLAKKGLRPSQIGVILRDSHGSAQVRFVTGNQILRVLKAKGLAPDLPEDIYHLIKKAVAMRKHLERNRKDTDSKFRLILVESRIHRLGRYYKTKGVLPPNWKYESATASALVA
Target: RPS13