RHXIIIRh polypeptide 2RhPIIRhesus D antigenCD_antigen: CD240D
Recombinant Human Blood group Rh (D) polypeptide (RHD), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: RHD. Target Synonyms: RHXIIIRh polypeptide 2RhPIIRhesus D antigenCD_antigen: CD240D. Accession Number: Q02161. Expression Region: 388~417aa. Tag Info: N-Terminal 6Xhis-Gst-Tagged. Theoretical MW: 33.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight:
33.6kDa
Tag:
N-Terminal 6Xhis-Gst-Tagged
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity:
>85% by SDS-PAGE
Sequence:
LNLKIWKAPHEAKYFDDQVFWKFPHLAVGF
Target:
RHD
* VAT and and shipping costs not included. Errors and price changes excepted