Recombinant Neisseria meningitidis serogroup C / serotype 2a Quinolinate synthase A (nadA), Unconjugated, E. coli

Catalog Number: BIM-RPC25622
Article Name: Recombinant Neisseria meningitidis serogroup C / serotype 2a Quinolinate synthase A (nadA), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25622
Supplier Catalog Number: RPC25622
Alternative Catalog Number: BIM-RPC25622-20UG,BIM-RPC25622-100UG,BIM-RPC25622-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: nadA, NMC1772, Quinolinate synthase A, EC 2.5.1.72
Recombinant Neisseria meningitidis serogroup C / serotype 2a Quinolinate synthase A (nadA) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18). Target Name: nadA. Target Synonyms: nadA, NMC1772, Quinolinate synthase A, EC 2.5.1.72. Accession Number: A1KVN9. Expression Region: 1~370aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 44.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 44.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MQTAARRSFDYDMPLIQTPTSACQIRQAWAKVADTPDRETAGRLKDEIKALLKEKNAVLVAHYYVDPLIQDLALETGGCVGDSLEMARFGAEHEADTLVVAGVRFMGESAKILCPEKTVLMPDLEAECSLDLGCPEEAFSAFCDQHPDRTVVVYANTSAAVKARADWVVTSSVALEIVSYLKSRGEKLIWGPDRHLGDYICRETGADMLLWQGSCIVHNEFKGQELAALKAEHPDAVVLVHPESPQSVIELGDVV
Target: nadA