Recombinant Dog Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA) (X155S,X158S), Unconjugated, E. coli

Catalog Number: BIM-RPC25614
Article Name: Recombinant Dog Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA) (X155S,X158S), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25614
Supplier Catalog Number: RPC25614
Alternative Catalog Number: BIM-RPC25614-20UG,BIM-RPC25614-100UG,BIM-RPC25614-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Canine
Conjugation: Unconjugated
Alternative Names: PPP1CA, Serine/threonine-protein phosphatase PP1-alpha catalytic subunit, PP-1A, EC 3.1.3.16
Recombinant Dog Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA) (X155S,X158S) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Dog (Canis familiaris, Canine). Target Name: PPP1CA. Target Synonyms: PPP1CA, Serine/threonine-protein phosphatase PP1-alpha catalytic subunit, PP-1A, EC 3.1.3.16. Accession Number: Q8WMS6. Expression Region: 2~330aa(X155S,X158S). Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 42.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 42.3kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: SDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDSFNSLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYE
Target: PPP1CA