Recombinant Human Fatty acid synthase (FASN), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC25596
Article Name: Recombinant Human Fatty acid synthase (FASN), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC25596
Supplier Catalog Number: RPC25596
Alternative Catalog Number: BIM-RPC25596-20UG,BIM-RPC25596-100UG,BIM-RPC25596-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: [Acyl-carrier-protein] S acetyltransferase, [Acyl-carrier-protein] S malonyltransferase, 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase, 3-oxoacyl-[acyl-carrier-protein] reductase, 3-oxoacyl-[acyl-carrier-protein] synthase, Enoyl-[acyl-carrier-protein] reductase, FAS, FAS_HUMAN, FASN, Fatty acid synthase, MGC14367, MGC15706, OA 519, Oleoyl-[acyl-carrier-protein] hydrolase, SDR27X1, Short chain dehydrogenase/reductase family 27X member 1
Recombinant Human Fatty acid synthase (FASN), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FASN FAS. Target Synonyms: [Acyl-carrier-protein] S acetyltransferase, [Acyl-carrier-protein] S malonyltransferase, 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase. Accession Number: P49327. Expression Region: 2155~2495aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 41.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 41.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DSLMSVEVRQTLERELNLVLSVREVRQLTLRKLQELSSKADEASELACPTPKEDGLAQQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQ
Target: FASN FAS