Recombinant Mouse CCN family member 5 (Ccn5), Unconjugated, Yeast

Catalog Number: BIM-RPC25578
Article Name: Recombinant Mouse CCN family member 5 (Ccn5), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25578
Supplier Catalog Number: RPC25578
Alternative Catalog Number: BIM-RPC25578-20UG,BIM-RPC25578-100UG,BIM-RPC25578-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: CCN family member 5Connective tissue growth factor-like proteinCTGF-L
Recombinant Mouse CCN family member 5 (Ccn5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Ccn5. Target Synonyms: CCN family member 5Connective tissue growth factor-like proteinCTGF-L. Accession Number: Q9Z0G4. Expression Region: 24~251aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 26.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 26.5kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QLCPAPCACPWTPPQCPPGVPLVLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNGRRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVCDQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNRFCQLEIQRRLCLSRPCLASRSHGSWNSAF
Target: Ccn5