Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha, Unconjugated, Yeast

Catalog Number: BIM-RPC25557
Article Name: Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25557
Supplier Catalog Number: RPC25557
Alternative Catalog Number: BIM-RPC25557-20UG,BIM-RPC25557-100UG,BIM-RPC25557-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Reptile
Conjugation: Unconjugated
Alternative Names: Aggretin alpha chainRhodoaggretin subunit alpha
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit alpha is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Calloselasma rhodostoma (Malayan pit viper) (Agkistrodon rhodostoma). Target Name: Calloselasma rhodostoma Snaclec rhodocytin subunit alpha. Target Synonyms: Aggretin alpha chainRhodoaggretin subunit alpha. Accession Number: Q9I841. Expression Region: 1~136aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 17.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 17.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GLEDCDFGWSPYDQHCYQAFNEQKTWDEAEKFCRAQENGAHLASIESNGEADFVSWLISQKDELADEDYVWIGLRAQNKEQQCSSEWSDGSSVSYENLIDLHTKKCGALEKLTGFRKWVNYYCEQMHAFVCKLLPY
Target: Calloselasma rhodostoma Snaclec rhodocytin subunit alpha