Recombinant Human Protein S100-A14 (S100A14), Unconjugated, Yeast

Catalog Number: BIM-RPC25539
Article Name: Recombinant Human Protein S100-A14 (S100A14), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25539
Supplier Catalog Number: RPC25539
Alternative Catalog Number: BIM-RPC25539-20UG,BIM-RPC25539-100UG,BIM-RPC25539-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: S100 calcium-binding protein A14S114S100A15
Recombinant Human Protein S100-A14 (S100A14) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: S100A14. Target Synonyms: S100 calcium-binding protein A14S114S100A15. Accession Number: Q9HCY8. Expression Region: 1~104aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 13.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 13.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH
Target: S100A14