Recombinant Human COP9 signalosome complex subunit 2 (COPS2), Unconjugated, Yeast

Catalog Number: BIM-RPC25428
Article Name: Recombinant Human COP9 signalosome complex subunit 2 (COPS2), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25428
Supplier Catalog Number: RPC25428
Alternative Catalog Number: BIM-RPC25428-20UG,BIM-RPC25428-100UG,BIM-RPC25428-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Alien homologJAB1-containing signalosome subunit 2Thyroid receptor-interacting protein 15
Recombinant Human COP9 signalosome complex subunit 2 (COPS2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: COPS2. Target Synonyms: Alien homologJAB1-containing signalosome subunit 2Thyroid receptor-interacting protein 15. Accession Number: P61201. Expression Region: 1~443aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 53.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 53.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAH
Target: COPS2