Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83), Unconjugated, Yeast

Catalog Number: BIM-RPC25402
Article Name: Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25402
Supplier Catalog Number: RPC25402
Alternative Catalog Number: BIM-RPC25402-20UG,BIM-RPC25402-100UG,BIM-RPC25402-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: Cancer/testis antigen 83
Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CT83. Target Synonyms: Cancer/testis antigen 83. Accession Number: Q5H943. Expression Region: 1~113aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 14.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 14.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Target: CT83