Recombinant Arabidopsis thaliana Histone deacetylase HDT2 (HDT2), Unconjugated, Yeast

Catalog Number: BIM-RPC25398
Article Name: Recombinant Arabidopsis thaliana Histone deacetylase HDT2 (HDT2), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25398
Supplier Catalog Number: RPC25398
Alternative Catalog Number: BIM-RPC25398-20UG,BIM-RPC25398-100UG,BIM-RPC25398-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Conjugation: Unconjugated
Alternative Names: HD-tuins protein 2Histone deacetylase 2b
Recombinant Arabidopsis thaliana Histone deacetylase HDT2 (HDT2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: HDT2. Target Synonyms: HD-tuins protein 2Histone deacetylase 2b. Accession Number: Q56WH4. Expression Region: 1~306aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 34.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 34.3kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MEFWGVAVTPKNATKVTPEEDSLVHISQASLDCTVKSGESVVLSVTVGGAKLVIGTLSQDKFPQISFDLVFDKEFELSHSGTKANVHFIGYKSPNIEQDDFTSSDDEDVPEAVPAPAPTAVTANGNAGAAVVKADTKPKAKPAEVKPAEEKPESDEEDESDDEDESEEDDDSEKGMDVDEDDSDDDEEEDSEDEEEEETPKKPEPINKKRPNESVSKTPVSGKKAKPAAAPASTPQKTEEKKKGGHTATPHPAKK
Target: HDT2