Recombinant Arabidopsis thaliana Cyclin-dependent kinase B1-2 (CDKB1-2), Unconjugated, Yeast

Catalog Number: BIM-RPC25385
Article Name: Recombinant Arabidopsis thaliana Cyclin-dependent kinase B1-2 (CDKB1-2), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25385
Supplier Catalog Number: RPC25385
Alternative Catalog Number: BIM-RPC25385-20UG,BIM-RPC25385-100UG,BIM-RPC25385-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Conjugation: Unconjugated
Alternative Names: CDKB1, 2
Recombinant Arabidopsis thaliana Cyclin-dependent kinase B1-2 (CDKB1-2) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: CDKB1-2. Target Synonyms: CDKB1, 2. Accession Number: Q2V419. Expression Region: 1~311aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 37.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 37.6kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MEKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSQSIYIVRLLCVEHVIQSKDSTVSHSPKSNLYLVFEYLDTDLKKFIDSHRKGSNPRPLEASLVQRFMFQLFKGVAHCHSHGVLHRDLKPQNLLLDKDKGILKIADLGLSRAFTVPLKAYTHEIVTLWYRAPEVLLGSTHYSTAVDIWSVGCIFAEMIRRQALFPGDSEFQQLLHIFRLLGTPTEQQWPGVMALRDWH
Target: CDKB1-2