Recombinant Arabidopsis thaliana Flavonol 3-O-glucosyltransferase UGT71C1 (UGT71C1), Unconjugated, Yeast

Catalog Number: BIM-RPC25336
Article Name: Recombinant Arabidopsis thaliana Flavonol 3-O-glucosyltransferase UGT71C1 (UGT71C1), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25336
Supplier Catalog Number: RPC25336
Alternative Catalog Number: BIM-RPC25336-20UG,BIM-RPC25336-100UG,BIM-RPC25336-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: A. thaliana
Conjugation: Unconjugated
Alternative Names: Flavonol 3-O-glucosyltransferase UGT71C1 (EC:2.4.1.91)Flavonol 7-O-glucosyltransferase UGT71C1
Recombinant Arabidopsis thaliana Flavonol 3-O-glucosyltransferase UGT71C1 (UGT71C1) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Arabidopsis thaliana (Mouse-ear cress). Target Name: UGT71C1. Target Synonyms: Flavonol 3-O-glucosyltransferase UGT71C1 (EC:2.4.1.91)Flavonol 7-O-glucosyltransferase UGT71C1. Accession Number: O82381. Expression Region: 1~481aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 56.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 56.4kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MGKQEDAELVIIPFPFSGHILATIELAKRLISQDNPRIHTITILYWGLPFIPQADTIAFLRSLVKNEPRIRLVTLPEVQDPPPMELFVEFAESYILEYVKKMVPIIREALSTLLSSRDESGSVRVAGLVLDFFCVPMIDVGNEFNLPSYIFLTCSAGFLGMMKYLPERHREIKSEFNRSFNEELNLIPGYVNSVPTKVLPSGLFMKETYEPWVELAERFPEAKGILVNSYTALEPNGFKYFDRCPDNYPTIYPIG
Target: UGT71C1