Recombinant Rotavirus X Outer capsid protein VP4, Unconjugated, Yeast

Catalog Number: BIM-RPC25310
Article Name: Recombinant Rotavirus X Outer capsid protein VP4, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25310
Supplier Catalog Number: RPC25310
Alternative Catalog Number: BIM-RPC25310-20UG,BIM-RPC25310-100UG,BIM-RPC25310-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Hemagglutinin
Recombinant Rotavirus X Outer capsid protein VP4 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) (RV ADRV-N) (Rotavirus (isolate novel adult diarrhea rotavirus-B219)). Target Name: Rotavirus X Outer capsid protein VP4. Target Synonyms: Hemagglutinin. Accession Number: A9Q1L0. Expression Region: 1~249aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 30.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 30.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MSLRSLLITTEAVGETTQTSDHQTSFSTRTYNEINDRPSLRVEKDGEKAYCFKNLDPVRYDTRMGEYPFDYGGQSTENNQLQFDLFTKDLMADTDIGLSDDVRDDLKRQIKEYYQQGYRAIFLIRPQNQEQQYIASYSSTNLNFTSQLSVGVNLSVLNKIQENKLHIYSTQPHIPSVGCEMITKIFRTDVDNENSLINYSVPVTVTISVTKATFEDTFVWNQNNDYPNMNYKDLIPAVTKNSIYHDVKR
Target: Rotavirus X Outer capsid protein VP4