Recombinant Rabies virus Glycoprotein (G), partial, Unconjugated, Yeast

Catalog Number: BIM-RPC25300
Article Name: Recombinant Rabies virus Glycoprotein (G), partial, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25300
Supplier Catalog Number: RPC25300
Alternative Catalog Number: BIM-RPC25300-20UG,BIM-RPC25300-100UG,BIM-RPC25300-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Rabies virus
Conjugation: Unconjugated
Alternative Names: GGlycoprotein
Recombinant Rabies virus Glycoprotein (G), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Rabies virus (strain PM) (RABV). Target Name: G. Target Synonyms: GGlycoprotein. Accession Number: A3RM22. Expression Region: 20~459aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 51.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 51.4kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: KFPIYTIPDKLGPWSPIDIHHLSCPNNLVVEDEGCTNLSGFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVKTTKESLVIISPSVADLDPYDKSLHSRVFPSGKCSGITISSTYCSTNHDYTIWMPENPRLGTSCDIFTNSRGKRASKGGKTCGFVDERGLYKSLKGACKLKLCGVLGLRLMDGTWVAMQTSDETKWCPPD
Target: G