Recombinant Aspergillus niger Probable alpha-galactosidase B (aglB), Unconjugated, Yeast

Catalog Number: BIM-RPC25297
Article Name: Recombinant Aspergillus niger Probable alpha-galactosidase B (aglB), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25297
Supplier Catalog Number: RPC25297
Alternative Catalog Number: BIM-RPC25297-20UG,BIM-RPC25297-100UG,BIM-RPC25297-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: Melibiase B
Recombinant Aspergillus niger Probable alpha-galactosidase B (aglB) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Aspergillus niger (strain CBS 513.88 / FGSC A1513). Target Name: aglB. Target Synonyms: Melibiase B. Accession Number: A2QEJ9. Expression Region: 21~443aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 48.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 48.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DGVGRTPALGWNSWNAYSCDIDADKIVTAANEVVNLGLKDLGYEYINIDDCWSVKSGRNTTTKRIIPDPDKFPNGISGVADQVHALGLKLGIYSSAGLTTCAGYPASLGYEEIDAQSFAEWGIDYLKYDNCGVPTNLTDQYTYCVPDSTDGSNYPNGTCVNLTDAAPQGYDWATSTTAKRYQRMRDALLSVNRTILYSLCDWGQADVNAWGNATGNSWRMSGDITATWSRIAEIANENSFLMNYANFWGYPDPDM
Target: aglB