Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1), Unconjugated, Yeast

Catalog Number: BIM-RPC25277
Article Name: Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25277
Supplier Catalog Number: RPC25277
Alternative Catalog Number: BIM-RPC25277-20UG,BIM-RPC25277-100UG,BIM-RPC25277-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: P12, Prostatic secretory glycoprotein
Recombinant Mouse Serine protease inhibitor Kazal-type 1 (Spink1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: Spink1. Target Synonyms: P12, Prostatic secretory glycoprotein. Accession Number: P09036. Expression Region: 24~80aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 8.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 8.1kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AKVTGKEASCHDAVAGCPRIYDPVCGTDGITYANECVLCFENRKRIEPVLIRKGGPC
Target: Spink1