Recombinant Bovine Odorant-binding protein, Unconjugated, Yeast

Catalog Number: BIM-RPC25273
Article Name: Recombinant Bovine Odorant-binding protein, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25273
Supplier Catalog Number: RPC25273
Alternative Catalog Number: BIM-RPC25273-20UG,BIM-RPC25273-100UG,BIM-RPC25273-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Bovine
Conjugation: Unconjugated
Alternative Names: Olfactory mucosa pyrazine-binding protein
Recombinant Bovine Odorant-binding protein is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Bovine (Bos taurus). Target Name: Bovine Odorant-binding protein. Target Synonyms: Olfactory mucosa pyrazine-binding protein. Accession Number: P07435. Expression Region: 1~159aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 21kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 21kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: AQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE
Target: Bovine Odorant-binding protein