Recombinant Hepatitis delta virus genotype I Small delta antigen, Unconjugated, Yeast

Catalog Number: BIM-RPC25267
Article Name: Recombinant Hepatitis delta virus genotype I Small delta antigen, Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC25267
Supplier Catalog Number: RPC25267
Alternative Catalog Number: BIM-RPC25267-20UG,BIM-RPC25267-100UG,BIM-RPC25267-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: p24
Recombinant Hepatitis delta virus genotype I Small delta antigen is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Hepatitis delta virus genotype I (isolate Italian) (HDV). Target Name: Hepatitis delta virus genotype I Small delta antigen. Target Synonyms: p24. Accession Number: P06934. Expression Region: 1~195aa. Tag Info: N-Terminal 6Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 25.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 25.4kDa
Tag: N-Terminal 6Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MSRSESRKNRGGREEILEQWVAGRKKLEELERDLRKTKKKLKKIEDENPWLGNIKGILGKKDKDGEGAPPAKRARTDQMEVDSGPRKRPLRGGFTDKERQDHRRRKALENKKKQLSAGGKNLSKEEEEELRRLTEEDERRERRVAGPPVGGVIPLEGGSRGAPGGGFVPSLQGVPESPFSRTGEGLDIRGNRGFP
Target: Hepatitis delta virus genotype I Small delta antigen