Recombinant Bovine coronavirus Spike glycoprotein (S), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22541
Article Name: Recombinant Bovine coronavirus Spike glycoprotein (S), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22541
Supplier Catalog Number: RPC22541
Alternative Catalog Number: BIM-RPC22541-20UG,BIM-RPC22541-100UG,BIM-RPC22541-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: E2, Peplomer protein
Recombinant Bovine coronavirus Spike glycoprotein (S), partial is a purified Recombinant Protein, Coronavirus Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bovine coronavirus (strain vaccine) (BCoV) (BCV). Target Name: S. Target Synonyms: E2, Peplomer protein. Accession Number: P25194. Expression Region: 326~540aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 27.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT
Target: S