Recombinant Human HLA class I histocompatibility antigen, A alpha chain (HLA-A), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22522
Article Name: Recombinant Human HLA class I histocompatibility antigen, A alpha chain (HLA-A), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22522
Supplier Catalog Number: RPC22522
Alternative Catalog Number: BIM-RPC22522-20UG,BIM-RPC22522-100UG,BIM-RPC22522-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: MHC class I antigen A*1HLAA
Recombinant Human HLA class I histocompatibility antigen, A alpha chain (HLA-A), partial is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HLA-A. Target Synonyms: MHC class I antigen A*1HLAA. Accession Number: P30443. Expression Region: 25~308aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 36.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36.7kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQ
Target: HLA-A